PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10003231m
Common NameCARUB_v10003231mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 329aa    MW: 36699.4 Da    PI: 10.1665
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10003231mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.76.4e-091258347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     +W+ +Ed  + +a + +  +   +W++Ia  ++ g+t +q++++++ +
  Carubv10003231m 12 SWSRDEDIAFERALAIYADEnenRWEKIALVVP-GKTKEQIIEHYNVL 58
                     7****************999*************.***********976 PP

2Myb_DNA-binding41.23.8e-13118162347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT  E+ +++ + +++G+g+W++I+r++ ++Rt  q+ s+ qky
  Carubv10003231m 118 PWTSTEHRQFLLGLEKFGKGDWRSISRHFVLTRTSTQVASHAQKY 162
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.551863IPR017884SANT domain
SMARTSM007173.8E-10961IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-111167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-51160IPR009057Homeodomain-like
CDDcd001671.95E-101259No hitNo description
PfamPF002491.8E-71258IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-10109165IPR009057Homeodomain-like
PROSITE profilePS5129415.686110167IPR017930Myb domain
SuperFamilySSF466891.5E-15112167IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-15114165IPR006447Myb domain, plants
SMARTSM007179.2E-9115165IPR001005SANT/Myb domain
CDDcd001671.44E-8118162No hitNo description
PfamPF002493.2E-10118162IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MILGENVSVG SSWSRDEDIA FERALAIYAD ENENRWEKIA LVVPGKTKEQ IIEHYNVLVR  60
DVTMIESGLV PLPACFGFSE EPNHNASGQG KSALEYGEYH RKTHDKSKPK QTRKRGIPWT  120
STEHRQFLLG LEKFGKGDWR SISRHFVLTR TSTQVASHAQ KYYQRLNSKN KHKNRASIHD  180
VTVAGDKPKQ RAITWQTFAS TSNNQLIQPA SQPSLELPIH GRRNIWNTQA TQAISQPPAL  240
NHPTAYGVPT TIWNAATLQP SANFHVYGTP TISQPMVGPM LSPFGTNMNR LAQPHMTSGV  300
HFVPSYSGPN APINMGSIPY DIKPKDRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-141073871RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256333e-37AB025633.2 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQM1.
GenBankCP0026883e-37CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBankDQ0566853e-37DQ056685.1 Arabidopsis thaliana myb family transcription factor (At5g23650) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289672.10.0hypothetical protein CARUB_v10003231mg
SwissprotQ8S9H79e-50DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0HC280.0R0HC28_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0006_22421e-142(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133911628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23650.11e-140Homeodomain-like transcriptional regulator